Loading...
Statistics
Advertisement

Ikinci Bahar - Stichting Turkse Ouderen - Home
www.ikincibahar.nl/
Ikinci Bahar - Stichting Turkse Ouderen Tilburg Tweede Lente - Stichting Turkse Ouderen Tilburg

Ikincibahar.nl

Advertisement
Conversion Technology Metas Server
Ikincibahar.nl is hosted in Netherlands . Ikincibahar.nl uses HTTPS protocol. Number of used technologies: 5. First technologies: CSS, Html, Html5, Number of used javascripts: 7. First javascripts: Jquery.min.js, Jquery-noconflict.js, Jquery-migrate.min.js, Number of used analytics tools: 0. Its server type is: Apache/2.

Technologies in use by Ikincibahar.nl

Technology

Number of occurences: 5
  • CSS
  • Html
  • Html5
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 7
  • jquery.min.js
  • jquery-noconflict.js
  • jquery-migrate.min.js
  • caption.js
  • bootstrap.min.js
  • template.js
  • html5fallback.js

Server Type

  • Apache/2

Powered by

  • PHP/5.5.20

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Ikincibahar.nl

SSL certificate

    • name: /C=US/ST=Someprovince/L=Sometown/O=none/OU=none/CN=localhost/emailAddress=webmaster@localhost
    • subject:
      • C: US
      • ST: Someprovince
      • L: Sometown
      • O: none
      • OU: none
      • CN: localhost
      • emailAddress: webmaster@localhost
    • hash: c4d44870
    • issuer:
      • C: US
      • ST: Someprovince
      • L: Sometown
      • O: none
      • OU: none
      • CN: localhost
      • emailAddress: webmaster@localhost
    • version: 0
    • serialNumber: 10304818881647671008
    • validFrom: 130222091747Z
    • validTo: 400709091747Z
    • validFrom_time_t: 1361524667
    • validTo_time_t: 2225438267
    • extensions:

    Meta - Ikincibahar.nl

    Number of occurences: 4
    • Name: viewport
      Content: width=device-width, initial-scale=1.0
    • Name:
      Content: 1
    • Name: description
      Content: Ikinci Bahar - Stichting Turkse Ouderen Tilburg Tweede Lente - Stichting Turkse Ouderen Tilburg
    • Name: generator
      Content: Joomla! - Open Source Content Management

    Server / Hosting

    • IP: 128.140.220.200
    • Latitude: 52.38
    • Longitude: 4.90
    • Country: Netherlands

    Rname

    • ns3.flexwebhosting.com
    • ns2.flexwebhosting.nl
    • ns1.flexwebhosting.nl
    • mail.ikincibahar.nl

    Target

    • hostmaster.ikincibahar.nl

    HTTP Header Response

    HTTP/1.1 200 OK Date: Thu, 26 May 2016 03:21:17 GMT Server: Apache/2 X-Powered-By: PHP/5.5.20 Set-Cookie: 732e9fecdb89fb6283eab9cc05e683d9=ec1fae49b2db8a735683080c5576819f; path=/; HttpOnly P3P: CP="NOI ADM DEV PSAi COM NAV OUR OTRo STP IND DEM" Expires: Mon, 1 Jan 2001 00:00:00 GMT Last-Modified: Thu, 26 May 2016 03:21:17 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=utf-8 X-Cache: MISS from s_lu10 X-Cache-Lookup: MISS from s_lu10:80 Via: 1.1 s_lu10 (squid/3.5.12) Connection: keep-alive

    DNS

    host: ikincibahar.nl
    1. class: IN
    2. ttl: 86400
    3. type: A
    4. ip: 128.140.220.200
    host: ikincibahar.nl
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns3.flexwebhosting.com
    host: ikincibahar.nl
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.flexwebhosting.nl
    host: ikincibahar.nl
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.flexwebhosting.nl
    host: ikincibahar.nl
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns1.flexwebhosting.nl
    5. rname: hostmaster.ikincibahar.nl
    6. serial: 2100000069
    7. refresh: 14400
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 86400
    host: ikincibahar.nl
    1. class: IN
    2. ttl: 86400
    3. type: MX
    4. pri: 10
    5. target: mail.ikincibahar.nl
    host: ikincibahar.nl
    1. class: IN
    2. ttl: 86400
    3. type: TXT
    4. txt: v=spf1 ?all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.kincibahar.nl, www.irkincibahar.nl, www.rkincibahar.nl, www.ifkincibahar.nl, www.fkincibahar.nl, www.ivkincibahar.nl, www.vkincibahar.nl, www.ikkincibahar.nl, www.kkincibahar.nl, www.i,kincibahar.nl, www.,kincibahar.nl, www.ibkincibahar.nl, www.bkincibahar.nl, www.igkincibahar.nl, www.gkincibahar.nl, www.itkincibahar.nl, www.tkincibahar.nl, www.iykincibahar.nl, www.ykincibahar.nl, www.iukincibahar.nl, www.ukincibahar.nl, www.ijkincibahar.nl, www.jkincibahar.nl, www.imkincibahar.nl, www.mkincibahar.nl, www.inkincibahar.nl, www.nkincibahar.nl, www.iincibahar.nl, www.iktincibahar.nl, www.itincibahar.nl, www.ikincibahar.nl, www.iincibahar.nl, www.ikgincibahar.nl, www.igincibahar.nl, www.ikbincibahar.nl, www.ibincibahar.nl, www.iknincibahar.nl, www.inincibahar.nl, www.ikhincibahar.nl, www.ihincibahar.nl, www.ikyincibahar.nl, www.iyincibahar.nl, www.iklincibahar.nl, www.ilincibahar.nl, www.ikoincibahar.nl, www.ioincibahar.nl, www.ikuincibahar.nl, www.iuincibahar.nl, www.ikiincibahar.nl, www.iiincibahar.nl, www.ikmincibahar.nl, www.imincibahar.nl, www.ikncibahar.nl, www.ikirncibahar.nl, www.ikrncibahar.nl, www.ikifncibahar.nl, www.ikfncibahar.nl, www.ikivncibahar.nl, www.ikvncibahar.nl, www.ikikncibahar.nl, www.ikkncibahar.nl, www.iki,ncibahar.nl, www.ik,ncibahar.nl, www.ikibncibahar.nl, www.ikbncibahar.nl, www.ikigncibahar.nl, www.ikgncibahar.nl, www.ikitncibahar.nl, www.iktncibahar.nl, www.ikiyncibahar.nl, www.ikyncibahar.nl, www.ikiuncibahar.nl, www.ikuncibahar.nl, www.ikijncibahar.nl, www.ikjncibahar.nl, www.ikimncibahar.nl, www.ikmncibahar.nl, www.ikinncibahar.nl, www.iknncibahar.nl, www.ikicibahar.nl, www.ikinncibahar.nl, www.ikincibahar.nl, www.ikinhcibahar.nl, www.ikihcibahar.nl, www.ikinjcibahar.nl, www.ikijcibahar.nl, www.ikinkcibahar.nl, www.ikikcibahar.nl, www.ikinlcibahar.nl, www.ikilcibahar.nl, www.ikin cibahar.nl, www.iki cibahar.nl, www.ikinibahar.nl, www.ikincdibahar.nl, www.ikindibahar.nl, www.ikincribahar.nl, www.ikinribahar.nl, www.ikinctibahar.nl, www.ikintibahar.nl, www.ikincvibahar.nl, www.ikinvibahar.nl, www.ikincfibahar.nl, www.ikinfibahar.nl, www.ikincgibahar.nl, www.ikingibahar.nl, www.ikinchibahar.nl, www.ikinhibahar.nl, www.ikincnibahar.nl, www.ikinnibahar.nl, www.ikincmibahar.nl, www.ikinmibahar.nl, www.ikincjibahar.nl, www.ikinjibahar.nl, www.ikincbahar.nl, www.ikincirbahar.nl, www.ikincrbahar.nl, www.ikincifbahar.nl, www.ikincfbahar.nl, www.ikincivbahar.nl, www.ikincvbahar.nl, www.ikincikbahar.nl, www.ikinckbahar.nl, www.ikinci,bahar.nl, www.ikinc,bahar.nl, www.ikincibbahar.nl, www.ikincbbahar.nl, www.ikincigbahar.nl, www.ikincgbahar.nl, www.ikincitbahar.nl, www.ikinctbahar.nl, www.ikinciybahar.nl, www.ikincybahar.nl, www.ikinciubahar.nl, www.ikincubahar.nl, www.ikincijbahar.nl, www.ikincjbahar.nl, www.ikincimbahar.nl, www.ikincmbahar.nl, www.ikincinbahar.nl, www.ikincnbahar.nl, www.ikinciahar.nl, www.ikincibqahar.nl, www.ikinciqahar.nl, www.ikincibwahar.nl, www.ikinciwahar.nl, www.ikincibzahar.nl, www.ikincizahar.nl, www.ikincibxahar.nl, www.ikincixahar.nl, www.ikincibahar.nl, www.ikinciahar.nl, www.ikincibsahar.nl, www.ikincisahar.nl, www.ikincibyahar.nl, www.ikinciyahar.nl, www.ikincibeahar.nl, www.ikincieahar.nl, www.ikincibdahar.nl, www.ikincidahar.nl, www.ikincibcahar.nl, www.ikincicahar.nl,

    Other websites we recently analyzed

    1. drawwritenow.com
      Lansing (United States) - 67.225.133.85
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    2. İzmirdeki Tüm Mekan ve Dükkanlar - İzmir Evreni
      İzmirin Sanal Reklam Ağı İzmirdeki Tüm Dükkan ve Mekanların Reklamlarını Yayınlıyoruz.imagedummyipsumprintingindustrytextsimplypictureloremtypesettingreklamcafehediyelikhergdaapartfastfoodeyizantaindustryzmrdekindustrysiteindustrypreviousnextsampleamacimizeyaevrenielektrikelektronikbistrodkkancopyrightbacklinkayakkabclasspreviewenerjiakaryaktemlakaperatifevrenievrenevrenireklamreklamletmzmrdekszlemesiyasaltamaclkspotsitemapreklamlarnsayfazmrtantmtarihizccaciyezmiryurtwaffletekstilvizyonumuzpetotomamllerimarketzmirevrenicomdesignletiimkincikiralamamekanlarizmirdekimekanlarreklamreklamizmirzmrizmirnaatnakliyemimarlkmhendislikmekanlarzmirinjiyansimply dummydummy textprinting typesettinglorem ipsumtext printingipsum simplyheresample imageimage describedescribe imageindustry loremtypesetting industryimage heresamplehediyelik kozmetikhal ayakkabeyiz alverieya aydnlatmagaziemir sitemapgiyim naatelektronik mobilyaara kiralamaaperatif sporanta otomotivaksesuar nakliyeasanal reklambujiteri fastfoodelence tekstilclasspreview zmircafelerpreviousnextsample pictureevren amacimizindustrysite mapteknoloji elektriktantm yazlartamaclk mobilturizmtatil hertypesetting industrypreviousnextsampleyurt biliimykama zccaciyewaffle eitimkrtasiyeshop backlinksemtleriizmir tarihilanlari letmzmrdekjiyan kinogizlilikzmir evrenizmirzmirevrenizmirletiim gzellikbakmpastaneunlu mamllerireklamlarn yaynlyoruzsamplereklam zmirdekipicture loremimage herepreviousnextsampleimage heresample imageipsum simply dummyprinting typesetting industrydummy text printingsimply dummy textindustry lorem ipsumtypesetting industry loremindustrypreviousnextsample picture lorembistro pastaneunlu mamllerijiyan kinogizlilik szlemesiyasalcafe gaziemir sitemapimage herepreviousnextsample pictureclasspreview zmir evrenienerjiakaryakt turizmtatil hermekanlarzmirin sanal reklamtamaclk mobil ototantm yazlar pettypesetting industrypreviousnextsample picturewaffle eitimkrtasiye gdareklamlarn yaynlyoruzsample imageprinting typesetting industryzmrdekmekanlarreklamreklamizmirzmrizmir semtleriizmir tarihizmir evrenizmirzmirevrenizmir evrenievrenevrenireklamreklampicture lorem ipsumprinting typesetting industrysiteletiim gzellikbakm emlak
      Germany - 146.0.42.37
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Iframe, Javascript, jQuery Cycle, jQuery Fancybox, Php, SuperFish
      Number of Javascript: 16
      Number of meta tags: 10
    3. Danny's Pizza | A Great Restaurant in Douglas, Georgia
      Scottsdale (United States) - 184.168.165.1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, SVG, WordPress Stats, Wordpress
      Number of Javascript: 14
      Number of meta tags: 4
    4. Agence Phiphi PLUS - Agence de Communication PHIPHI+
      Provo (United States) - 50.87.163.120
      G Analytics ID: UA-80660667-1
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php, Google Analytics, Joomla
      Number of Javascript: 14
      Number of meta tags: 3
    5. Welkom bij Toyota dealer Autobedrijf Alex van de Velde Zuidzande B.V.
      Dit is de officiële Toyota dealerwebsite van Autobedrijf Alex van de Velde Zuidzande B.V. met o.a. de (hybride) Toyota modellen, Occasions, Acties en Nieuws..
      Netherlands - 193.239.132.218
      Server software: Microsoft-IIS/8.5
      Technology: Carousel, CSS, Html, Html5, Javascript, Google Analytics
      Number of Javascript: 7
      Number of meta tags: 6
    6. Double Blessing International
      Provo (United States) - 162.144.23.71
      Server software: nginx/1.10.1
      Technology: CSS, Html
      Number of meta tags: 3
    7. Õ也坏酵
      Mong Kok (Hong Kong) - 103.27.110.3
      Server software: IIS
      Technology: Html, Javascript
      Number of Javascript: 2
      Number of meta tags: 1
    8. Nathan Ogilvie - Art Director - Gallery
      San Francisco (United States) - 151.101.12.245
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, jQuery, SVG, Google Analytics, New Relic
      Number of Javascript: 14
      Number of meta tags: 9
    9. fuzzoff.com
      East Lansing (United States) - 64.85.171.16
      Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    10. washbear.de
      Hier entsteht
      Germany - 89.31.143.16
      Server software: Apache
      Technology: CSS, Html, SVG
      Number of meta tags: 3

    Check Other Websites